SI
SI
discoversearch

We've detected that you're using an ad content blocking browser plug-in or feature. Ads provide a critical source of revenue to the continued operation of Silicon Investor.  We ask that you disable ad blocking while on Silicon Investor in the best interests of our community.  If you are not using an ad blocker but are still receiving this message, make sure your browser's tracking protection is set to the 'standard' level.
Gold/Mining/Energy : Gold and Silver Juniors, Mid-tiers and Producers -- Ignore unavailable to you. Want to Upgrade?


To: koan who wrote (17202)7/31/2006 12:39:28 AM
From: koan  Read Replies (2) | Respond to of 78419
 
And:

A chemistry of small numbers, a quantum chemistry, is needed to account for life's emergence.

To see how quantum mechanics might have been involved in life's origin, imagine the primoridal soup-(paraphrased ot save time-lol).

The self replicating peptide can be written in one letter amino acid code a rmkqleekvyellskvacleyevarlkkvge-lol.

how was the first self-replicator assembled?
There are 20 to 23 or 10 to 41 possible ways to put peptides together which are 32 amino acids long.

If primoridal chemistry managed to syntheisize just one molecule of each possible peptide then the total mass must have weighed about 10 to 18 kilograms. Far more than the total mass of todays tropical rainforests. There is no warm pond to big enough to make so many peptides.

My note,: but in the quantum world this is not a problem!